OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Appearance: Powder

Purity: >99% (or refer to the Certificate of Analysis)

Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

Solubility: To be determined

Shelf Life: >2 years if stored properly

---

Our factory

“Strength builds the foundation, and excellent services reach all over the world.” Create win-win situation with customers